SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00212.2|PACid:22046449 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00212.2|PACid:22046449
Domain Number 1 Region: 25-121
Classification Level Classification E-value
Superfamily POZ domain 8.63e-18
Family BTB/POZ domain 0.0088
Further Details:      
 
Weak hits

Sequence:  Aquca_010_00212.2|PACid:22046449
Domain Number - Region: 512-551
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00212.2|PACid:22046449
Sequence length 601
Sequence
MKKSLQANTSQCVAIVEKFEKKERSWFPTSQIPTDLIIHVQDINFYVHKLPLISKSECLS
DLLKSRPSQSNSSCDIKLDNFPGGAETFELIIKFCYGFSVDLTASNVAPVRCAAEFLQMT
EEYEEGNLISKTESFIAFIVLSSWRDSITVMKSCECLSTWAENLQILRKCTDAVALKIIR
RTSMCNDTDYDGERWWFDDISILCIDHFVRIITAIRAKGSKPEIIGASIMHYAEKWLPGM
EELQGQKGFGHRKNELHMTILSGKWEEGNVGQEKEQRRMIEVLVSILPPQREAVPCKFLL
SMLKMALVYTATTALVSELEKRVGMVLGDATVYDLLIPIPSYNNGTEGKLGSPSEERRTM
HDVDTIQRIVEYFLMHEQQLQQQQSNVGKLLDGYLTEIARDPNLSIAKFQALAEVLPQDA
RTCHDGLYRAIDTYLKTHPTLMEHDRRRLCKPMDCEKLSLDGCMHAAQNDRLPLRTVMQV
LYSEQIKMRAAMNGKGPMQHDIMCEQDSTWSTKKEIKNIISELQKIRTSIEELQHDYSQL
QQEFEKANKQKIVSGWSSGWKKFKTSTLFHGKMNAMDTENVQLGQTTVSSKNSRRRRKSI
S
Download sequence
Identical sequences A0A2G5E8U6
Aquca_010_00212.2|PACid:22046449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]