SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00264.1|PACid:22047425 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00264.1|PACid:22047425
Domain Number 1 Region: 2581-2861
Classification Level Classification E-value
Superfamily BEACH domain 7.85e-121
Family BEACH domain 0.0000000132
Further Details:      
 
Domain Number 2 Region: 2971-3229
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.11e-38
Family WD40-repeat 0.0049
Further Details:      
 
Domain Number 3 Region: 1087-1287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.81e-21
Family Clostridium neurotoxins, the second last domain 0.04
Further Details:      
 
Domain Number 4 Region: 2389-2431,2485-2548
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-18
Family PreBEACH PH-like domain 0.0057
Further Details:      
 
Domain Number 5 Region: 167-241,284-359,392-409,555-587
Classification Level Classification E-value
Superfamily ARM repeat 0.0000537
Family Armadillo repeat 0.08
Further Details:      
 
Weak hits

Sequence:  Aquca_010_00264.1|PACid:22047425
Domain Number - Region: 875-1040
Classification Level Classification E-value
Superfamily ARM repeat 0.000822
Family Clathrin heavy-chain linker domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00264.1|PACid:22047425
Sequence length 3245
Sequence
MNIVKGVADLLRRTSSFQAGESGSWPQGQRFAAPSPRICFSEVDEEAILGTLWRRYENTI
DKVERRKLFYVFLKQFLIVYKDWEPAHADQVPEAGSSTTAEYLSGVDDIVVGCSAGHPAE
IILILTQEIAELTSLVSELHTSTESTTDLQQTSVSLNIVTEGFPVLDALAIITRSMHNCK
VFGYYGGMQKLTALMKAAVVQLKTFSGALVDENLSNNSVEKSKVLQKILLHVITVICCFI
DLNSHMYERAVEFSVARFGTCLIDPPRSVEKCASETRLHWHQKAIVSVMEAGGLNWLVEL
LRVMRRLSMKEQWTDMTLQYLTLATLKSALSENPRGQNHFRSIGGLEVLLDGLGFPSNKT
LTSKNIFGDDMERNENTFLAIFELQVLSLEVLREAVFGNLSNLQFLCENGRVHKFANNIC
WPAFALQEFQHQRVQFYGQANSEMPVLDSEKEIHAESSSRQHATPFDANGFHQSWNDYAV
KLSTVLCSFLLALEDIRFHSIQATVGRSVVAVSSVYWELSIKWVMKVLLIVFPCIKACTN
QNELPGHLRVFVNTLQHYILYAFRKVLVSLPTLLQVFREEGMWDLLFSESFFYFGASSEG
ISGDFSRYNEGILRKIELCSSSNSASAALKANEVEILKLEIVSFVEFAATFNGAMHNLPE
CSVLMDALEQSSCNPELANVLAKSLHRILQLATEQSAASFKSLDAISRVLKVVCIQAQEF
RRCRNNNLVAENELLERHLHQNGQSSGTSEIDQCWLKCMETSLDLFKEYLSLADDAKSIV
LHNSTCIDCLFDLFWEEALRKFALTHILDLMKLPPSSDKDQVAKLYLCSKYLETFTCVKE
REKNFAELSIDLLLGVREMLEANQKYYQALFCDGECFLHIVSLLNGSLDDRSGELLVLNV
LQTLTSLLCRNDVSKGAFRALVGKGYQTLQNLLLDVCESQPSKGLLSALLDMLVDGNFDV
KATPIIKNEDVIILFLSVLQKSSESLRHFGLNVFQQLLKDSISNRATCVRAGMLNFLLEW
FPQEDDNNVILEISQLIQVIGGHSISGKDIRKIFALLRNGKIGSRQLYCSLLLTSMLSMF
KEKGPIAFFDLNGSDSGIVIKTPLQWPHNKGFSFTCWVRVENFPRTGTMGLFSFLTENGR
GCSAAFGKDKLFFESINQKQQCVPLQHRMSPKKWHFLCITHSIGRAFSGGSLLRCYLDGA
LVSSEKCRYSKVSDPLIHCTIGRNVTPQLSAEELPMVAIKDTSPFLGQIGPVYMLNDAIS
LEQIQGIYSLGPSYMYSFLDNEVAYSSNNTLLNGIFDVRDGLASKINIGLNAQACDGKTL
FNVAPVLDHTLDKSSFEAVVLTGTQLCSRRLLQQIIYCVGGVSVFFPLLTQLDSSEYPES
GQLGDTLLRCVIRECLTAEVIELIAAVLDENLANQQQMHLLSGFSILGFLLQSVPPQKIN
LETISALIHLYNVVANCGMSELLVRDAISSVFLNPFIWVYTAYKVQLELYMFLIQQFDYS
PTLLSTLCCLPRIIDIIHQFYWDKTKSRSAYGSKPLLDPISKEVIGERPSHEDVRKIRLL
LLSLGEMSLRQSIAAADIKSLVAFFERSQDTACIEDVLHMVTRAISQKPLFTSFLEQVNL
IGGCHIFINLLQREFEPVRLLGLQFVGRLMVGLPSEKKGPRFFNLGVGRSRSLSESHKKI
NIKLQPIVSAMSDRLFKFSQTDLLCATLFDVLLGGASPRQVLQKHNQPERHWSKGSNSHF
FLPQMLVLIFKFLSNCQYVSTKAKILTDLVDLLDSNPLNIEALVEYSWHSWLATSVKLDV
FNSSHGDDIISEQYLVRKVFCVVLSYYTHSVKGGWHQLEETVNFLLGNSEERKHSHWNFI
HEIFDDLAERLVILSSEENIFVAQPCRDNTLYLLKLIDEMLIFETEQKLPYPESNLDLSS
DSLEFGSHKDSNSRVVDSFYGDADKLLPSNRWWNLYDKIWLIITEMNGKGPSRMLPKSSS
SAGPSLGQRARGLVESLNIPAAEMAAVVVSGSIGNALGGKPNKTSDKAMILRGEKCPRIF
FRLVILYLCKSSLERALKCVQQVISLLPCLLTADDEHSKSRLQLFIWSLLTVRSHYGTLD
DGARFHVISRLIRETVNTGKSMLATSIAAKDDISDSGSNMKEAGSIHTLIQKDRVVAAVA
DEVKYMKTSKADRTKQVQELRVRMHENSSAESFDKKAFEDETQSILSNIMSSDDSRRAAF
QLAHDEDQQIVAEKWVHIFRTLIDERGPWSANPFPNTTLTHWKLDKTEDSWRRRPKLRRN
YHFDEKLCHPSPTVPSKEAIDIVKEGKSGFGSHIPEQMRRLLLKGVRRITDEAAEPVNDT
EPSDPKASSPYDPMDVQCTESTKDNMDHKEAIQERKESSSNVSETEMSEVLLSVPCVLVT
PKRKVAGHLAVMKHVLHFFGEFLVEGTGGSSVFSNFNLPCNSESTKLEKVEGAHKHTLLQ
SPTNLCVDYEKSRTSGNPITDHEPLLSKLPKIKRHRRWSVSRVKSVHWTRYLLRYTAIEI
FFDDSVAPVFFNFASHKAAKDVGILIVSTRNDPLFTKGSSRDRIGTISFVDRRVALEMAE
IAQECWKRRDMTNFEYLMILNTLAGRSYNDLTQYPVFPWILADYSSEKLDFNKSSTFRDL
TKPVGALDLRRFEVFEDRYRNFSDPDIPSFYYGSHYSSMGIVLFYLLRLEPFTSLHRNLQ
GGKFDHADRLFQSIEGTYRNCLSNTSDVKELIPEFFYMPEFLANSNSYHLGVKQDGDPLG
DVCLPPWAKGSAEEFIHTNREALESEYVSSNLHHWIDLVFGYKQRWKPAVEAANIFYYLT
YEGAVDLDTMEDELQRNAIEDQIANFGQTPIQIFRKKHPRRGPPIPILRPLYFAPGSINL
TSVVANTTHPPSAVLYISILDSNIVLVSQGLTMSVKMWLTTQLQSGGNFTFSGSQDPFFG
IGSDVLSSRRIASPLAENIELRAQFFAAMQTPSGNFLVSCGNWENSFQVISLNDGQTVQT
VRHHKDVVSCVAVASDGSILATGSYDTTVMVWEVSRVKATEKRVRNAQMELPRKDYIVVE
TPFHILCGHDDIITCLFVSVELDIVISGSKDGTCIFHTLREGRYVRSLQHPSGSALSKLV
ASRHGRIVCYAEDDLSLNMYSINGKHIATSESNGRLNCVELSNCGEFLVCAGDHGQIVVR
SMNSLEVVKRYDGIGKVITSLTVTLEECFLAGTKDGSLLVYSIDNPQLRKSSLPRNLKSK
ASAVG
Download sequence
Identical sequences A0A2G5E992
Aquca_010_00264.1|PACid:22047425 Aquca_010_00264.2|PACid:22047422 Aquca_010_00264.3|PACid:22047423 Aquca_010_00264.4|PACid:22047424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]