SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00339.4|PACid:22046365 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00339.4|PACid:22046365
Domain Number 1 Region: 6-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-22
Family B3 DNA binding domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00339.4|PACid:22046365
Sequence length 163
Sequence
MNRISSAPSFFKLLIHDFSQQLCLPTDYINNFNGDVPKQFILTSSTRRSWEVSVKKVDND
LFLCEKWPNFAKDNALEFGDLLVFIYNGNSEFDVKIFGSNACEKEVELALKNNIESNSYV
REKKDGKDMENSDKLHSQVMLKCYKRRRTNEAVVTDKMTRHSK
Download sequence
Identical sequences A0A2G5E9F7
Aquca_010_00339.4|PACid:22046365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]