SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00343.4|PACid:22046467 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00343.4|PACid:22046467
Domain Number 1 Region: 21-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.8e-23
Family B3 DNA binding domain 0.0016
Further Details:      
 
Domain Number 2 Region: 174-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000294
Family B3 DNA binding domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00343.4|PACid:22046467
Sequence length 242
Sequence
MSRATSKQRGAEQFSPPVNKRKTSFFKIIHGNIIADQQLVLPTKFVTKHGNEFSDNVTLK
VPNGSVWTIKLNKDDGKICLCAGWKDFVEYHSIHAGHVLIFRYDGKSCFYVIICDMTTVE
INYPSETVNKLEKATRAGKILTSRQNLGSKTELEDDDDVQILNVRANRDDADTFKSRYPF
FKISMNASYLSRKFMNIPVEFCKNYLPKGLESLTLEVSNGRKKCRVRCLPVCSQNRGLRM
RG
Download sequence
Identical sequences A0A2G5EA27
Aquca_010_00343.4|PACid:22046467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]