SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00344.1|PACid:22046370 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00344.1|PACid:22046370
Domain Number 1 Region: 23-117
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-24
Family B3 DNA binding domain 0.00049
Further Details:      
 
Domain Number 2 Region: 198-299
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-19
Family B3 DNA binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00344.1|PACid:22046370
Sequence length 311
Sequence
MVKIYKKRSSLSSSSSFDNVGCQFFKVYLPAHSSIRLKIPTAFINSFNGILPEKIMLKDS
VGRVWHVEVKEVENDFFFQSGWQEFVKMHSLVVGEFLVFRYDGNSTFEVKLYDHSGCEKE
ETLDDKNINKAVCFIKEEDNKEASNARRKPILAICDSKHKGSKVLKKADKSRYGFSRPER
ISAKYVQKNMVSKASETDQPKPHFDVVVNGNGTARYFVHIPKQVLIDNNIKIQPKIFLRD
PNGKSWPASVRFAKDGRTQICSGWYDFCKGNNLKENDKCKFEFLQTRSRGKFIIDVHIPR
TKRKGFCVADT
Download sequence
Identical sequences A0A2G5E9H5
Aquca_010_00344.1|PACid:22046370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]