SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00425.1|PACid:22047059 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00425.1|PACid:22047059
Domain Number 1 Region: 50-111
Classification Level Classification E-value
Superfamily Homeodomain-like 7.1e-16
Family Homeodomain 0.008
Further Details:      
 
Weak hits

Sequence:  Aquca_010_00425.1|PACid:22047059
Domain Number - Region: 103-150
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00425.1|PACid:22047059
Sequence length 204
Sequence
MNQENAHLFFNIQDHTSSLYTYATSAEGETKKKKRQRRKKDKNEGGADARKRKLSAAQVN
GLETYFSIDHNLETQRKERIASELGLDPQQVAIWFQNRRVRWRVKKLEDEYYKLKATHEN
VIVEKSQLESQVLRLKAQLSDAQNEMTRLVERSDGVSSNSQSSSFSMDMDPFFLGDFGME
GLEKVFYFNNSVNGMEWVNNVYDM
Download sequence
Identical sequences A0A2G5E9U5
Aquca_010_00425.1|PACid:22047059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]