SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00652.2|PACid:22047398 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00652.2|PACid:22047398
Domain Number 1 Region: 21-175
Classification Level Classification E-value
Superfamily Chalcone isomerase 5.62e-54
Family Chalcone isomerase 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00652.2|PACid:22047398
Sequence length 206
Sequence
MTSSDLSSSSSSLARLNMELKVEDYTFCPTLSTAPGSANSFFLGGAGVRGLQIQDKFIKF
TAIGVYLEEQKAISSLAVKWNGKSAEELTDSIEFFRDIVTGPFEKFIMVTMILPLTGQQY
SDKVVENCVAAWKAMGIYTEAESKAVEEFIQVFKDETFPPGSSILFTQSSPALTELWSKV
LYYAGPHHTDALSIRLNLQGYIRDYL
Download sequence
Identical sequences A0A2G5EAZ1
Aquca_010_00652.2|PACid:22047398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]