SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00652.3|PACid:22047399 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00652.3|PACid:22047399
Domain Number 1 Region: 21-179
Classification Level Classification E-value
Superfamily Chalcone isomerase 1.06e-54
Family Chalcone isomerase 0.00000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00652.3|PACid:22047399
Sequence length 201
Sequence
MTSSDLSSSSSSLARLNMELKVEDYTFCPTLSTAPGSANSFFLGGAGVRGLQIQDKFIKF
TAIGVYLEEQKAISSLAVKWNGKSAEELTDSIEFFRDIVTGPFEKFIMVTMILPLTGQQY
SDKVVENCVAAWKAMGIYTEAESKAVEEFIQVFKDETFPPGSSILFTQSSPALTVSIPNH
IWNAVALDLDLVQGQLLHISL
Download sequence
Identical sequences A0A2G5EB02
Aquca_010_00652.3|PACid:22047399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]