SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00709.2|PACid:22046630 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00709.2|PACid:22046630
Domain Number 1 Region: 79-474
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.44e-126
Family ArgJ-like 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00709.2|PACid:22046630
Sequence length 477
Sequence
MALSLNNYISVKIPELNRKNKFCSWRVSSRCNCRFIVSSSLFSSTMSTEDQSSNYIPAAP
ILLPEGPWKQVPGGVTAAKGFKAAGMYGGLRAKGEKPDLALVTCDVDAISAGVFTTNVVA
AAPVIYCRQTLDNSDTARAVLINAGQANAATGDAGYQDVIECATAVAKLLQLRPEEILIE
STGVIGQRIKKEALLNSLPKLVDSLSSTIKGADNAAVAITTTDIVSKSVAIETEVGGSLI
RVGGMAKGSGMIHPNMATLLGVITTDALVTSDLWRSMVLTAVNRSFNQITVDGDTSTNDT
VIALASGTSGSTRISSLSSYEARQLQACLDAVMQGLAKSIAWDGEGATCLIEVTVTGANN
EAEAAKIARSVASSSLTKAAIYGRDPNWGRIACAAGYAGILFHPNDLRISLGDIILMDKG
QPLPFDRDAASAYLRRAGETHDTVKICIGVGNGQGQGQAWGCDLSYDYVKINAEYTT
Download sequence
Identical sequences A0A2G5EB96
Aquca_010_00709.2|PACid:22046630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]