SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00709.3|PACid:22046631 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00709.3|PACid:22046631
Domain Number 1 Region: 79-447
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 2.09e-109
Family ArgJ-like 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00709.3|PACid:22046631
Sequence length 450
Sequence
MALSLNNYISVKIPELNRKNKFCSWRVSSRCNCRFIVSSSLFSSTMSTEDQSSNYIPAAP
ILLPEGPWKQVPGGVTAAKGFKAAGMYGGLRAKGEKPDLALVTCDVDAISAGVFTTNVVA
AAPVIYCRQTLDNSDTARAVLINAGQANAATGDAGYQDVIECATAVAKLLQLRPEEILIE
STGVIGQRIKKEALLNSLPKLVDSLSSTIKGADNAAVAITTTDIVSKSVAIETEVITTDA
LVTSDLWRSMVLTAVNRSFNQITVDGDTSTNDTVIALASGTSGSTRISSLSSYEARQLQA
CLDAVMQGLAKSIAWDGEGATCLIEVTVTGANNEAEAAKIARSVASSSLTKAAIYGRDPN
WGRIACAAGYAGILFHPNDLRISLGDIILMDKGQPLPFDRDAASAYLRRAGETHDTVKIC
IGVGNGQGQGQAWGCDLSYDYVKINAEYTT
Download sequence
Identical sequences A0A2G5EB86
Aquca_010_00709.3|PACid:22046631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]