SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00053.1|PACid:22038539 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00053.1|PACid:22038539
Domain Number 1 Region: 28-81
Classification Level Classification E-value
Superfamily Tim10-like 2.88e-16
Family Tim10/DDP 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00053.1|PACid:22038539
Sequence length 84
Sequence
MDSSSPSISAQEKYQLQQFVQQQEQAVMLHEIVSKITRVCWDKCISSTPGSKFSSSESAC
LANCARRFMDVSMIVKTRLENSSP
Download sequence
Identical sequences A0A2G5E5F2
Aquca_011_00053.1|PACid:22038539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]