SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00095.1|PACid:22037765 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00095.1|PACid:22037765
Domain Number 1 Region: 42-149
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000159
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00095.1|PACid:22037765
Sequence length 155
Sequence
MPTKEEEEKGVVSGEFPLTPIRTQRVEIRNTPPKLLDLLTPWECEKVMTASDVSHYGAVV
LGREHIQRHWGLDWTALNRGTQVAVTIRDVETRTDHNLLLGKTLEDVFLLHNNWLKDFVF
RRNLKEGDTIGMYWNRTSSSICFSVLKRATGMRME
Download sequence
Identical sequences A0A2G5E5K5
Aquca_011_00095.1|PACid:22037765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]