SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00141.1|PACid:22038081 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00141.1|PACid:22038081
Domain Number 1 Region: 476-764
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-77
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 84-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-26
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  Aquca_011_00141.1|PACid:22038081
Domain Number - Region: 366-410
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.051
Family Pan module (APPLE domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00141.1|PACid:22038081
Sequence length 802
Sequence
MEDRCRTCLFLSAFMFFFFFFFLCTKTFLCFAADTMSSGQSLSLNQTLISKSENFELGYF
QPSNSTNYYVGIWFKKVSVQPRTVVWIGNRNIPVIDPSTSELKLLEDGNLVLFNQSKVVI
WSTNSASSAMNSSEVVLGDDGNLVLRNRIRPSDVFWQSFDHPTDTWLPGAKLRYDNRTKK
SQILASWKSPNDPTEGLFSLDIDPSGDQHFLLWNRTLRYWSSGRWNGQIFSGIPEMRSDH
FFNFSYVKNENETYFTYSLYNTSIICREVLELSGQLHLYIWDEDKQKWFLFWSVPRQQCE
VYAFCGANGVCNQNGLPFCTCMDGFEPRSQKEWKLSDYSSGGCVRKTSLHCGDRHTFSLM
SKVKLPANPQRLTAASADDCKLTCLSNCSCIAYAYTSICSVWDGDLLNLQQLSDDEDAGE
DLYLRLATSDIRKSGGKDKETHTGGIMGGVAGIAALLCIALFLWRWRMRLSIGKSNTVEG
SLFAFAYKDLQNATKNFSEKLGCGGFGSVFKGTLPDSTAIAVKKLESLGQGEKQFRTEVS
TIGTIQHVNLVRLRGFCSEGDSRLLVYDYMPNGSLDYHMFGQHDSAMMNWKTRYQIALGI
ARGLSYLHEKCRDCIIHCDIKPENILLDANFSPKVADFGLAKLIGRDFSRVLTTMRGTRG
YLAPEWISGVAITAKADVYSYGMVLFEIVSGRRNSEHSEDGKFFPTWAAHKIIEDENVLA
LLDCRLQGDTNAEELTRACRVACWCIQDEESHRPSMGQVVQILEGVVEVNLPPIPRAIQV
LVEIEENIHFFSEETANPNSQV
Download sequence
Identical sequences A0A2G5E5T2
Aquca_011_00141.1|PACid:22038081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]