SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00142.1|PACid:22038128 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00142.1|PACid:22038128
Domain Number 1 Region: 441-683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-71
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 49-158
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.1e-27
Family alpha-D-mannose-specific plant lectins 0.0034
Further Details:      
 
Weak hits

Sequence:  Aquca_011_00142.1|PACid:22038128
Domain Number - Region: 319-378
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00053
Family Pan module (APPLE domain) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00142.1|PACid:22038128
Sequence length 735
Sequence
MSSGQSLNLNQTLISKSGIYELGYFQPGNSPNYYIGIWYKKISIQNKTVVWVGNRNTPVT
DPFTAELKLLEDGNLVLLNQSKAVVWSTNSSLNPLNSSVAVLGDDGNLVLRKGDKPSDVF
WQSFDYPTDTWLPGGRFRYDNRIKKSQLLTSWKSPNDPSEGLISLRIDPSGGQFVILWNR
TRRYWSSGQWNGQIFSGIPDTRLLHFLNFSFLKNENESVFTYSLNNTSIISWLVLELSGQ
IKQYTWDEKHKRRFCFGAYQGNNVMFMPFVALSGVCNQRSFPFCTCMDGFKPRYEEEWNL
SNYSSGGCVRKTSLQCGDKDNFFLMPNVKLRDNAQRLAVASADDCKLACWSNCNCSAYAY
TSFCSIWDADLLSLQQLSDDEDGGEDLYLKLAASDFQKSGGKDKKTNTGVIVGAVAGIGA
ILVLVLFYIRRWRIGQSVGKSKSFEGSLMVFAYKDLQNATNNFYEKLGGGAFGSVFKGTL
PDSSVIAVKKLESLGQGEKQFRAEVSTIGTIQHVNLVRLCGFCSEGDTRLLVYDYMPNGS
LDYHIFGQNDSAMMNWKTRYQIALGIARGLSYLHEKCRDCIIHCDIKPENVLLDADFYPK
VADFGLAKLIGREFSRVLTTMRGTRGYLAPEWISGVAITVKADVYSYGMMLFEIVSGRRN
IDHSDEGKFVFFPIWAARKIIEDGNVLALLDSRLQGDANVEELTREPGIDFNETFAPVAR
METIRTVLAIAAQWR
Download sequence
Identical sequences A0A2G5E5V6
Aquca_011_00142.1|PACid:22038128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]