SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00143.1|PACid:22038497 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00143.1|PACid:22038497
Domain Number 1 Region: 436-731
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-75
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 50-131,163-194
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-27
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  Aquca_011_00143.1|PACid:22038497
Domain Number - Region: 328-370
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00334
Family Pan module (APPLE domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00143.1|PACid:22038497
Sequence length 770
Sequence
DTISSGQSLTLNQTLISKSGIYELGYFQPGNSSNYYIGIWYKNVSVQEKTVVWVGNRNTP
ITDPFSSELKLLEDGNLVLLNKSKTTVWSTNSASNVFNSSEAVLGDDGNLVLRNRVTPSD
VFWQSFDFPTDTWLPGARLRYDNRTKKSQLLTSWKNPNDPSEGLFSLELDPNEDLYFISW
NRTWRYWSSGPWDGKIFSGIPQMRSNYLFNISFVKNENESYYTYNTSLITRQVLDASGQL
KQLSWAKERWFLFWTQPIQKCDVYAFCGAFGVCKQRGYPLCTCMDGFKPQSPKDWNISDF
SSGGCVRNTSLQCGHRDAFSLMSNVKAPLNPRNLSVASADACKLACSDDCTCTAYTYSNG
CSIWNGDLFNLQQISGGETGGEDLYLRLVASDILKSGGQKKEKNTQVIGGALAGIVALLG
LVLFSICRWRRRLSIGTTKVVEGSLVPFTYKELQNATSNFSIKLGGGGFGSVFKGVLPDS
TSIAVKKLEGLAHHQGEKQFRTEVSTIGMIHHVNLVRLRGFCSEGDSRLLVYDYMLNGSL
NSHMFHQQYPYKLNWKTRYQIALGIARGLSYLHEKCRDCIIHCDIKPENILLDADFCPMV
ADFGLAKLIGRDFSRVLTTMRGTRGYLAPEWISGVAITEKADVYSYGMMLFEIISGRRNS
YHAEEEKFVFFPTWAARKLSEGENVLALLDYRLQGDAHVEELTRACRVACWCIQDDESHR
PSMGKVVQILEGVTEVSSPPIPRALLNLVMDEESSDFFTETTSNHSSLDV
Download sequence
Identical sequences A0A2G5E6D6
Aquca_011_00143.1|PACid:22038497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]