SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00240.1|PACid:22038166 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00240.1|PACid:22038166
Domain Number 1 Region: 378-700
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.96e-51
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 148-322
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.47e-20
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  Aquca_011_00240.1|PACid:22038166
Domain Number - Region: 715-817
Classification Level Classification E-value
Superfamily PH domain-like 0.000638
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00240.1|PACid:22038166
Sequence length 829
Sequence
MIHANATLLIQVNSKSTRHIARERQSQSSRVRVVGRENQCERVNSLCRKLLLLLLLLLLR
TFVLIPTTLMTVFSHNGGGFLTGKQVFPVNCESEVSQRLVEASHTSDLKSALECVSNPFV
DVNFIGAVCLKTRKTEVVLHDESANEVRIEYDEFRTDVTALFLAAHAGNLTLVQKLLSVG
ADVNQKLFRGFATTAAVREGHFKILEILLKAGASQPACEEALLEASCHGRARLSELLMGS
DMIRPHVAVHALVMACCRGFVDVVDSLIKCGVDVNAIDRILLQSSRPSLHTNADCTALVA
AVVSRHVPVVRQLLQIDVRTDILVRIGAWSWDTNSGEEFKVGAGLAEPYHITWCAVEYFE
ASGVILRMLLQNQSPNTPHYGRTLIHHAILCGNARALDVLLNCGADVEIPVKTTQGVVFR
PIHMAARLGSDRILQRLIDAGCDLNSQTESGETALMISAKYKKDECFRVLASAGADFGMV
NSSGHSVCSIAVTSRWSRGFQHALLNVIHSGSVVQSSNASIFSPLLFVAQTGDIEAIKVL
VKQPNTSLDDQDDNGLSALMVTAMEGHVEAFRLLVYAGANLRLCNKSGETAISLSELNQN
CDLFEKVLLEFALEKGNQGGFRVLHSAARRGDLAAVRLLIDRGYDVNVPDQDDYTPLMLA
AKEGHNSMCELLISCGARCDVKTARGETALSLARNSKNARVNTERVILDELARTFVLSGA
SVKKHTKKGKGSPHQKMMRMVGAAGVLRWGKSSRRNVICRDAEMGPSSVFERNRRRKGDA
YHPGVFRIITTKNKEFHFVCEGGAEIAEMWVRGIKLVTREAICGKKSET
Download sequence
Identical sequences A0A2G5E6E0
Aquca_011_00240.1|PACid:22038166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]