SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00338.1|PACid:22038291 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00338.1|PACid:22038291
Domain Number 1 Region: 65-188,272-337,373-398
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000011
Family WD40-repeat 0.071
Further Details:      
 
Weak hits

Sequence:  Aquca_011_00338.1|PACid:22038291
Domain Number - Region: 1001-1032
Classification Level Classification E-value
Superfamily CHY zinc finger-like 0.0405
Family CHY zinc finger 0.019
Further Details:      
 
Domain Number - Region: 568-622
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 0.0759
Family Arp2/3 complex 16 kDa subunit ARPC5 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00338.1|PACid:22038291
Sequence length 1056
Sequence
MMAKFVMDPSLNNNNSNNNNNNNNSNNNTTTTTNNNNNKGRTVLEPVAELDVPSLSKATS
SAPTIQCLAICTLSDSQTLVYVGTQSGTLILYSFNPNSSNSTPLSFSRSALVVTDRSLQS
IHTFANNLKVLVLSEDGSIFLLDSFLTQPVQRLSFPKGVSVVAPRLCSDLDSTLFGTSES
DINIPSGRRRLLQKLSGGGSRIGIRSALSYGGVKSSLDSSLEFPSSSNTTTTTSDVINNN
CLVAFAVGKRLILIQLVLPLATTDAAFPRGPVSVVIKEIQCVHQVKTMVWINDSIIVGTT
VDGYTLYSCVTGQSASMFSLPDPSSTPYLKSLCKGHEALLLVDNVGIIVNALGEPLGGSL
IFRHSPDAIAEISSYLIAVMNGRMDLYHKKTGLCVQSVSFAAQGVGPSIVVNEESRNGQL
VIVASSSYSKVFCFRKVSAEEQIKDLLKKKRFKEAIALVEELELEGEMTKEMLSFVHAQV
GFLLLFDLHFEEAVDHFLQSETMQPSEIFPFILPDPNRWSMEVSRNRYWGLHPPPVPLED
VVDEGLMAIQRAIYLKKAGVETAEDEYFLLNPPSRSDLLESAIENFIRYLWLSRNKDLTP
SVREGVDTLLMYLYRALNHVEKMELLASSENNCVVEELETLLEDSGHLRTLAYLYASKSL
SSKALAIWRMLAKNYSAYHWEDTSVEHTPQDACTDVVSRPMAAAIEASKLLEVSSDQDMV
LQHLGWVADVDHTLAVQVLTSEKRAVKLSPVAVIAAIDSKKVDILQRYLQWLIEDQDSDD
AQFHTLYALSLAKSALENTDIGEYSSARMSQETNAYDVEGSNYLSNLVRKRLQMFLQSSD
LYDPDEVLDLIEGSEFWLEKAILYRKLGQETLVLQILALKLEDSEAAEQYCVDIGRQDAY
KQLLDMYLDPQDGKDPMFKAAIHLLHNHGESLNPRQILETLSPDMPLQLASDIILKMLRA
RVHHHCQGQVVSNMSGAINIDAKLARLVERSRHVQINDESLCDSCHARLGTKLFAMYPDD
AIVCYKCFRRQGESASVSGRNFKQDIIFKPGWLVSP
Download sequence
Identical sequences A0A2G5E6R2
Aquca_011_00338.1|PACid:22038291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]