SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00504.1|PACid:22037768 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00504.1|PACid:22037768
Domain Number 1 Region: 19-212
Classification Level Classification E-value
Superfamily Chalcone isomerase 1.31e-16
Family Chalcone isomerase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00504.1|PACid:22037768
Sequence length 213
Sequence
MANLKHDPEMIEEVAEEVIEVKSGVSFPGKLADGKQLQAVGMRKKSLLGLGIKICSFGLY
ADNETLKELMRSKIKEAPTKPTKEMYQVVIDSDVEILLRMVMISGSLSMNMVKRGLTEDL
GASVQKLNGGQKNAELVNKVMENVSNSIKLTSGSLIEVTKFPGYRLGSKIKGEVVSNVES
ELLCRAYFDGYLGDDPFDKEAKEKFGASLLALF
Download sequence
Identical sequences A0A2G5E7F1
Aquca_011_00504.1|PACid:22037768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]