SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00537.2|PACid:22038068 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_011_00537.2|PACid:22038068
Domain Number 1 Region: 440-757
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-81
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 74-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-25
Family alpha-D-mannose-specific plant lectins 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00537.2|PACid:22038068
Sequence length 776
Sequence
MGRLYFVMFYAYILTLLSQEIPIAAYMLTSSQSIIDGKTLVSKGASFELGFFSPPSSKHR
YFGIWYKPVSVQTVVWVANRDSPITDTSGALKIGSTGNIVVVNQNDSVVIWSSKSTSSNI
AVENLIIELLDSGNLVLRDVRIEDPEKYLWQSFDYPGDTLLPGMKLGWKSKTGMNNYMQS
WRNSDDPSLGDYTFGIELTEYPESVILTNKSIKYYRSGPWNGLQFSGAPDMSRNRVFHYE
LVHNPDEVYYIYKVTDPSVTLRVVLTQTSTEGHLQRFTWVNQTQSWLLLVSIPRDRCDDY
ALCGAYSTCEVMTEPVCQCLKGFKPKSPQDWNETDWSQGCKRETFLNCSQGEGFLKYTGV
KLPDTTGTRVNRSMDLEECGVNCLKNCSCVAYSSSDISGSGSGCVMWFTDLIDIRQMDGA
GEDLYIRMAASELGVHEKEDFELPVFDLVTIKSATSNFAEENLLGEGGFGPVYKGKLEGD
QEIAVKRLSKSSIQGFSEFKNEVILISKLQHKNLVKLIGCCIQGEEKMLVYEYMPNKSLD
AFIFDETNSGLLDWQKRFDIILGIARGLLYLHHDSRLRIIHRDLKASNILLDSEMLPKIS
DFGMARLFRGDQNEANTERVMGTYGYMSPEYLIDGQFSVKSDVFSFGVLVLEIISGKKNR
GFCHPDHELNLLGHAWRLWCEDRSMELADESMIKSCSVQEVLRCIHIGLLCVQKGAEQRP
TMSTVVLMLSSESVALPKPQPPGFYVDRSTPMREISSYSDKSSASNEATITLIQGR
Download sequence
Identical sequences A0A2G5E7K7
Aquca_011_00537.2|PACid:22038068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]