SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_011_00557.1|PACid:22038236 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_011_00557.1|PACid:22038236
Domain Number - Region: 118-156
Classification Level Classification E-value
Superfamily PH domain-like 0.0492
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_011_00557.1|PACid:22038236
Sequence length 297
Sequence
MAGNLSIIPAENFQNSHNTAIKNKWEIHYSRFFNFPRSLSASCAKLRPLPKSRFRTGGNW
ISTSSTVTLRIARDFLNPGSILVVSFPDKIIEEHLTSNLQFSWPQVSCVTECPTRGSRVV
FASYRDYDGQIQKFALRFATSCDAETFIGALKESLKDDMETGVLRSEYESEISAQSEFLS
SNGQQLSAEELDMVEPVATYSPQTASLLEYTGRLNGFSKESLPGHNFERICEADLPPSFT
ALLGNHSPEVEIKQEQVKVPDEDLKSQIMKYISDASFHDMLAKVEEVISEMGGDLAL
Download sequence
Identical sequences A0A2G5E7N5
Aquca_011_00557.1|PACid:22038236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]