SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00026.1|PACid:22059849 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00026.1|PACid:22059849
Domain Number 1 Region: 155-277
Classification Level Classification E-value
Superfamily TPR-like 9.1e-16
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000261
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 377-495
Classification Level Classification E-value
Superfamily PH domain-like 0.00000801
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00026.1|PACid:22059849
Sequence length 511
Sequence
MSTEIEESEEQQIQQQNRGGGGGGGEKSELDSGNEQPEPVDPKLESNGSTDMDKRPVVEE
IERSEIRKDEGSRTFTMRELLKELKDDGNEPSSDAELLTTATASDGDRLDAISPYSQDDI
HQQYLGENNAAMELINSVTGVDEEGRSRQRILTFAAKRYASAIDRNPEDYDALYNWALVL
QESADNVSPDSSSPSKDALLEEACKKYDEATHLCPTLHDAFYNWAIAISDRAKMRGRTKE
AEELWKQATKNYEKAVQLNWNSPQALNNWGLALQELSAIVPAREKQTIVRTAISKFRAAI
QLQFDFHRAIYNLGTVLYGLAEDTLRTGRPVNAKDVSPNELYSQSAIYIAAAHALKPNYS
VYRSALRLVRSMLPLPYLKVGYMTAPPAGNPIAPHSDWKQSQFVLNHEGLLQLNKVEQKQ
LSQSPSGRMLGAVNIDKPAIKVDIPDIISVSACADLTLPPGAGLCIDTINGPIYLVAETW
ESLDGWIDAIRLVYTIFARGKSDVLAGVITG
Download sequence
Identical sequences A0A2G5DZA7
Aquca_013_00026.1|PACid:22059849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]