SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00026.2|PACid:22059850 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00026.2|PACid:22059850
Domain Number 1 Region: 155-277
Classification Level Classification E-value
Superfamily TPR-like 8.34e-16
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 
Domain Number 2 Region: 235-369
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000018
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 389-488
Classification Level Classification E-value
Superfamily PH domain-like 0.0000185
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00026.2|PACid:22059850
Sequence length 504
Sequence
MSTEIEESEEQQIQQQNRGGGGGGGEKSELDSGNEQPEPVDPKLESNGSTDMDKRPVVEE
IERSEIRKDEGSRTFTMRELLKELKDDGNEPSSDAELLTTATASDGDRLDAISPYSQDDI
HQQYLGENNAAMELINSVTGVDEEGRSRQRILTFAAKRYASAIDRNPEDYDALYNWALVL
QESADNVSPDSSSPSKDALLEEACKKYDEATHLCPTLHDAFYNWAIAISDRAKMRGRTKE
AEELWKQATKNYEKAVQLNWNSPQALNNWGLALQELSAIVPAREKQTIVRTAISKFRAAI
QLQFDFHRAIYNLGTVLYGLAEDTLRTGRPVNAKDVSPNELYSQSAIYIAAAHALKPNYS
VYRSALRLVRSMVGYMTAPPAGNPIAPHSDWKQSQFVLNHEGLLQLNKVEQKQLSQSPSG
RMLGAVNIDKPAIKVDIPDIISVSACADLTLPPGAGLCIDTINGPIYLVAETWESLDGWI
DAIRLVYTIFARGKSDVLAGVITG
Download sequence
Identical sequences A0A2G5DZ58
Aquca_013_00026.2|PACid:22059850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]