SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00067.1|PACid:22058790 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00067.1|PACid:22058790
Domain Number 1 Region: 127-265
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-38
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 616-698
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000216
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00067.1|PACid:22058790
Sequence length 737
Sequence
MAYSDNYRGSSISQSNFSGDRLETGFGVDELYTELWKACAGPLVDVPRTGERVFYFPQGH
MEQLEASTNQELSQRIPLFNLPSKILCRVVHIQLLAEQESDEVYAQITLQPEPDQNEPNS
PDPIPQELPRPVVHSFCKILTASDTSTHGGFSVLRKHANESLPPLDMTQSTPTQDLIAKD
LHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLRGENGDLRVGVRRLARQ
PSCMPSSVISSQSMHLGVLATASHAVSTQTLFIVYYKPRTSQFIISLNKYLEAVDHGFTV
GMRFKMRFEGEDSPERRFTGTIVGTGDISPQWKDSKWRSLKVQWDELASIQRPERVCPWE
IEPFVASAPPSNVIQSTIIKNKRPRQSVDNPVCGMDCLPCVFFINGTCTGFLIIILVSFT
DTSSAASAFWYPKSNLSHDLVALSGPEVQSSESQVVWPPRQKEGNLFNNSSTCSSKNLLD
GGWPSPLTKASLNLFQDVNVDDKTVPLWGVLGISGNDQAPKPIDFPVINDPVETGKKPEP
TGGCRLFGIELTNNSRAPPPVNVPTNQTVISSAGTEEVVQAPVFGANSNQQSGVSKVSGE
QGREFLQVSPKESQTKGPTCTRTRTKVHMQGIAVGRAVDLTGLQGYDQLIKELEDMFEIK
GQLCPRDKWEVVFTDDEGDMMLVGDDPWLEFCKMVKKIYIYLSQDVKKMTTGIKLPSSSL
EDEGTVISLDSELKKET
Download sequence
Identical sequences A0A2G5DZM5
Aquca_013_00067.1|PACid:22058790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]