SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00095.1|PACid:22059218 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00095.1|PACid:22059218
Domain Number 1 Region: 113-226
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000451
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00095.1|PACid:22059218
Sequence length 240
Sequence
MDDDIGKIKVFPDHFAASTPSGDSLEKQVSSVSQTRTDYSLRYHNRISTQRKLMGAASML
NMFSVPGLPWRSGKDDQEKAELTAESLRSEIAALEEREAHFKARLEHVDEILRSARLAGY
LHIRTRWTALPGEPPIDDTDVDDWLPRFVVLQGSCIFFYLLSTDLSPQDSTLLSDVVEVI
PLSSSIHEDGQRFIFHVLTRQGLRFECWSSSKSQVDSWLKALMEDCKLESDTTPRKTSES
Download sequence
Identical sequences A0A2G5DZR8
Aquca_013_00095.1|PACid:22059218 Aquca_013_00095.2|PACid:22059217 Aquca_013_00095.3|PACid:22059219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]