SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00095.5|PACid:22059221 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00095.5|PACid:22059221
Domain Number 1 Region: 60-173
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000222
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00095.5|PACid:22059221
Sequence length 187
Sequence
MGAASMLNMFSVPGLPWRSGKDDQEKAELTAESLRSEIAALEEREAHFKARLEHVDEILR
SARLAGYLHIRTRWTALPGEPPIDDTDVDDWLPRFVVLQGSCIFFYLLSTDLSPQDSTLL
SDVVEVIPLSSSIHEDGQRFIFHVLTRQGLRFECWSSSKSQVDSWLKALMEDCKLESDTT
PRKTSES
Download sequence
Identical sequences A0A2G5DZQ3
Aquca_013_00095.4|PACid:22059220 Aquca_013_00095.5|PACid:22059221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]