SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00152.1|PACid:22058719 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00152.1|PACid:22058719
Domain Number 1 Region: 692-1006
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.73e-50
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 421-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000668
Family Protein kinases, catalytic subunit 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00152.1|PACid:22058719
Sequence length 1009
Sequence
MEFNMMEGEGVESIEAVHHRRGKEIDSSNEMFDWRESSQQVSSDSFVGIDLNKLPKTENV
VMESCSINDEIDLVEELTLKVSENPNVVVDGNSNSTSIREGMPVIQGWKHLYRMAGGVGS
ESAHCKNASKDGGGVVTTQKHPQQLNQQSPEMSKPLVKTENNSESPSGIRTKVLSSSGFP
QFLVRNSLKGKGVVHRSSEQCDRFGAARMEQINEKTASVGGVISDTSQNLGVRDNQYTRQ
RVDEAGSDSIIGGIFLRDWIKPGCKVNRDESLRIFKRIVELVDIAHSQEVALQHVRPSCF
KLLPSDQVKYMGSIAQRELFENVMDMDVNYCSRKRSGKDRLPRSSTLKQQKLKKNTNSTR
QRCQSSAGAGFKGEPAKDIDFYSAGSQDSGYSMSQKYNLNPEHRMQNKFTIPFVSNTTQN
HLTPANLQLEDRWYTSPEEQNKREPTFSSDIYCLGVLLFELFCCFESCEVHTAAMLNLRY
RILPPKFLSEYPREAGFCLWLLHPEPSSRPTAREILYSELICGSQQVSEGQQSIPVDEDP
VESELLLHFLISLKELKHKRASKLVDDIRCIEADIVEVEKRHILRTTEVWKHKEPDARGK
EPASSHARLMNNINQLESAYFSMRSQIPVPDPVGTGRSDKELLNIRESCSQVVNESEGNR
PSDHLGVFFDGLCKYARYNKFELRGTLKNRDLLNSANVICSLSFDRDEEYFAAAGVSKKI
KIFELSGLLNDSIDIHYPVVEMTNKSKLSCVCWNNYIRNYLAATDYDGVVQLWDASTGQG
FSQYTEHEKRAWSVDFSPVDPTKLASGSDDFSVKLWSINERKCTSTIRSSANVCCVQFSA
DSTHLLAFGSADYKTYCYDLRNTRNPWCTLAGHGRAVSYVKFLDSNTLVSASTDNTLKLW
DLNKTSCSGLSTNSCSLTFRGHTNEKNFVGLSASDGYITCGSESNEVYAYYRSLPMPITA
HKFGSMDPISGQANGDDSEQFVSSVCWKGNSDMVIAANSSGSIKLLQMT
Download sequence
Identical sequences A0A2G5E008
Aquca_013_00152.1|PACid:22058719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]