SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00185.1|PACid:22059158 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00185.1|PACid:22059158
Domain Number 1 Region: 488-782
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-75
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 58-144
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-24
Family alpha-D-mannose-specific plant lectins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00185.1|PACid:22059158
Sequence length 848
Sequence
MTSCIANRIELGSRLVAGDNKAWVSDNRTFVFGFTPVNSKDQFQLAIWYGELPGDRVVVW
SANRNSPVGKDAALELDRTGNLVLVDKKVVVWVSNTSGAGVEVAQMSDSGNLILYNSTSD
PVWQSFSHPFDTLLPGQSLTVSLELTSAKTPSHGGYYTLKMLQETTSLSLGLTYNSADSY
NSSSDFHSNYSYWSGPEISNVTGDITAVLDEQGNFGIVYGASSEGIVYVYKNDVGNGGSQ
ARNRPINRSVLRRLTLEMNGNLRLYRWDNDVNGSQQWVPEWAAVSNPCDIAGTCGNGICN
LDGSKTNASCSCLPGTSQVAPGIQCVANSALTGNCDNLSHRNSKSQYKISTVPQTNYYYS
ELSVIANYSDISASSKCGDACLSDCECVASVYGLKEETAYCWILKSVEFGGFEDPGSTLF
VKVDKNGSTPPNTRTGNASKKSSSYRNKVLVLPIVLCMSVLVALLCFLLYYSFHRRRSIV
KAIKGSLTVSGAPLNFSYRDLQSGTNNFTQLLGAGGFGSVFKGSLGDGTLVAVKKLERFL
PHGQKEFITEVNTIGSMHHMNLVRLCGFCSEDSHRLLVYEFMKNGSLDRWIFPSYGSKKV
QDKLLDWNTRFQIAIETAQGIAYFHEQCRNRIIHCDIKPENILLDENFCPKVSDFGLAKL
MAREHSHVVTMVRGTRGYLAPEWVSNRPVTVKADVYSYGMLLLEIIGGRRNFDMSLDAEE
FYYPGWAFKEMANGTPNKVADKRLMGVLDEDQLVRALQVGFWCIQDEVWMRPSMGEVVKM
LEGSVEINPPPMPQTVLELVEEGLDHVYRAMRREFTRCQPASHISYSFSNATLPSSQATC
SYSTMSPR
Download sequence
Identical sequences A0A2G5E088
Aquca_013_00185.1|PACid:22059158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]