SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00216.2|PACid:22059265 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_013_00216.2|PACid:22059265
Domain Number - Region: 175-274
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00418
Family Myosin rod fragments 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00216.2|PACid:22059265
Sequence length 647
Sequence
MESEEKGRKEGAEKQEIGGLKWKRGVLVGKRGGPTTPSPTWKLEEELEEQEAEEQKRGGE
CAAQDNKRTTNSSSVSARKLCANLWEIQQHHHHYHLPLAKMNKGSMRIRHYKEKGLDFPT
NLADPSHTHTPPHQVATYYPPSTPASSLDSRRLGDSSHSLKTSTEFLKVLNRIWSLEEQH
ASNVSLVKALKIELNLAKAHIKELLQERQADHNEIDDLMKQLAEDKHFRKNKDSDRIKAA
LQSVRDELEDERKLRRRSESLHRKLARELSDVKSAFSSALKELEREKKARTMLEEFCDEF
ARGIGDYEQEVRSLRHKSENDPGGRDDQDRLIVHISEAWLDERLQMRLAESRCDMVEKNT
IVDKLSFEIETFLKARRTGNLNSNDFLSTRDSKINGYLRRHSLESFPLHGATSAPQDVDD
EEDSSSDSHCFELGNKNIGEKTTNGISNPKLHELGEEDVEGDYLEEPRRANSVKKKHGTV
ERFKGRNLSSSQIQVEEHMNRAMSCNERKTPYLNKEEKGGQEANETSISKKSENCETTDG
RRGKKDGTHGSNSNNVIDDLLNRSRLLLADSGRKEVHREDDGREDSSAWKGIASPVQQWV
SRFAAPDLEISESSSHRASSVKGNTLKARLMEARLEGQHSRLKASKG
Download sequence
Identical sequences A0A2G5E0D3
Aquca_013_00216.2|PACid:22059265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]