SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00270.1|PACid:22060214 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00270.1|PACid:22060214
Domain Number 1 Region: 99-245
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 6.02e-50
Family C-terminal domain of ribosomal protein L2 0.00000951
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.61e-21
Family Cold shock DNA-binding domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00270.1|PACid:22060214
Sequence length 263
Sequence
MGRVIRAQRKGHGGIFKAHTHHRKGPAKFRSLDFGEKHGYLKGVVTEIVHDPGRGAPLAR
VTFRHPFRYKHQKELFVAAEGMYTGQFIYCGKKAQLTVGNVLPIGTIPEGAVVCNVERKV
GDRGALARASGDYAIVISHNPENGTSRVKLPSGSKKIISSGCRAMVGQVAGGGRTEKPML
KAGNAYHKYRVKRNSWPKVRGVAMNPVEHPHGGGNHQHIGHGSCVGRDAVPGQRVGQLYA
RQTGRGRKGQATGTTSKTKADKA
Download sequence
Identical sequences A0A2G5E0K9
Aquca_013_00270.1|PACid:22060214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]