SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00351.7|PACid:22059424 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_013_00351.7|PACid:22059424
Domain Number - Region: 771-889
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00118
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00351.7|PACid:22059424
Sequence length 1003
Sequence
MFKSSRWRSEKNKIKVVFKLQFHATQVPQLAKDSLMVSLVPVEVGKPTVRLEKSAIQDGT
CRWENPIYETIKFIQEPKTGKISEKIYQFIVSTGSSKAGVLGEVTFDFANYFESIKPSSV
ALPLKALNSATILHVTIQRVSGAVDQRDNEENGIAENISQDRSLRRKMSDCDTDENRNCN
SIEDVSVNKTISQNSESNGNLTACKSSDGISASDSENSSERNTPRDLGLKNSNVHRDPGS
FLSSLSHSSMPHKPTTNAIITNYLEHQRSNTEWSVGSAPDGSVDDSTNSSDDILMKERSP
HASDTSVEKLRGDLVTLARQAEVSEIEIQTLRKQIVKESKRGQDLARDVISLKEERDALK
QECEQLKSSRKHNGDTKVSSKLQFQGEDSHTLLKEIRQELDYEKDLNVNLRIQLQKTQES
NSELLLAVQDLDEMLEQKNSEISYLSNKSVTNGNAEKRHDIVSKYETDDDEEQRALESLV
KEHDDAKDIYLLEQKIIDLYSEIEVYRRDRDELEMQMEQLALDYEILKQENHDLMSKLEQ
SHLQEQLKAQYECSDSLANLNELETQIESLENELKKQEEDFSASLVTINELKSQVEYLEK
ELEKQAQGYEADLDTVMHAKVEQEQRAIRAEEALRKTRLTNANTAERLQEEFRRLSMQMS
STFDANEKVAMKAVTEANELRLQKSHLEEMLDSVNEELSYVRDQYEEKIKELSNQIDMTK
EQAEHTLLELEEKSRKLEHQKEQEEKTCGTFSKEILMLRDEIEKLTEEKINLSKQAEQKE
KLEVEIENLKASITEAELLVQRGVMERNELENRIATVSKEADKFLKELNSTRSLKDEKET
MVGILQSEVETLKSQYNDLKHSLFEDELEKENLRKEVFNLKGELKKKEEIITSTEKKLKG
ASDGPKFSSKNSKAVPARGSKEATGLRERIKLLEIKLKEAALENSNNSFLEKEKDLQYKI
EELETRMVALSHSSLSCEDQLQKVRIFLVIVFSCFEVITKYYQ
Download sequence
Identical sequences A0A2G5E173
Aquca_013_00351.6|PACid:22059423 Aquca_013_00351.7|PACid:22059424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]