SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00444.3|PACid:22059981 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00444.3|PACid:22059981
Domain Number 1 Region: 191-322
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000001
Family Ran-binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00444.3|PACid:22059981
Sequence length 324
Sequence
MMQFASKRVMAGSPFDFNRAEPSRVAEKPALDAQRAESSQQHVRALNTQFASWVQSQLQN
HPDELWEDGVQDYLTHASHIMDKFRDVVDWLKTNAAKAESLPVFGASSTENKSIFETKNN
ETKFQLPEKSGFGQVGFTSGFTSAWSSSVPQKSQTSGFFGIQNPAPTTHDASDEPDGEDE
LEQPSSPSVKKSEEKGVVMVHEVKCKLYVKSTDPTDKDVWKDRGMGQLSIKCKEGVSKAT
KESKPTIVVRNDVGKILLNALLYPGIKTNLVKNAIAAIFHTSGDANGNDVATNGVVARTY
LIKTKTEEDRNKLASAIQEYAPAA
Download sequence
Identical sequences A0A2G5E1N4
Aquca_013_00444.3|PACid:22059981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]