SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00464.1|PACid:22060231 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00464.1|PACid:22060231
Domain Number 1 Region: 444-639,667-698
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.71e-29
Family Phospholipase D 0.079
Further Details:      
 
Domain Number 2 Region: 758-879,928-1018
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.68e-29
Family Nuclease 0.05
Further Details:      
 
Domain Number 3 Region: 269-422
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.09e-24
Family Synaptotagmin-like (S variant) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00464.1|PACid:22060231
Sequence length 1086
Sequence
MAGYPYGDPYRYPPSPSQQQQQGSDPYRYPPPPPQQQQGSDPYPPPPIHPYLYNPSYSFL
YPQPQPPPSAYSSHSRPIDYQYSSYPPPPHFAPPPGQAPYPSPYPDSSYPPPPPVNQTPA
HPSLQYNSSFQYESSTFYPPTESHHPPQHSRVHSFPQDNYVSATSGSNNPPLENSLDKLN
LSDNSPSAPPSPSVPLVSTTFQQSLSARYSQRTDIYGSPNNSFSSNNVDPSYTPRPAYVS
SPSFNGSQHGQGMQIVPVTSPKGSLRVMLLHGNLDIWVYEARNLPNMDMFHKTITDMFGK
RLPGSVTSKVDGHAPKVTSDPYVTVSVANAVVGRTYVISNNENPVWTQHFNVPVAHNASE
VHFVVKDSDVVGSQVIGLVAIPVEHAIAGNRIEGSFPILNMSNRKPCKPGAELRLSFQYI
PIERLTAYHHGVGSGPNYTGVPGTYFPLRQGGKVTLYQDAHVPDGSLPALKLDQGVDYEH
GKCWYDIMNAIRQARRLIYITGWSVYHNVKLVRDSPHVPDCTLGELLRTKSQEGVRVLLL
IWDDPTSRSILGYQTDGLMGTHDEETRRFFKHSSVQVILTPRSAGKRHSWAKQQETGTIY
THHQKSVIVDADAGRNMRKIIAFVGGLDLCDGRYDSPQHPVFRTLKTLHKDDYHNPSFTG
STAGCPREPWHDLHCKIDGPAAYDVLTNFEERWYKASKRSGIKKLKKGQDDALLQIDRIP
DIVGMSDTQRFTENDPEAWHVQIFRSIDSNSVKGFPKDPRDATNKNLVCGKNVLIDMSIH
TAYVNAIRAAQHFIYIENQYFLGSSYNWTQYRDLGANNLIPMEIALKIASKIRANERFAV
YIVVPMWPEGIPTGTATQRILFWQHKTMQMMYETIYKALEEAGLEQAFVPQDYLNFFCLG
NREAPDGSDSSFGGSPNAANSSQVLTRKSRRFMIYVHSKGMIVDDEYVILGSANINQRSM
EGTRDTEIAMGAYQPEHTWARKLSSPHGQIHGYRMSLWAEHTGTLEDCFTQPESIDCVRR
IRSMGEYNWRQFAADEVTEMRGHLMRYPVEVDRRGKVRSLPGCETFPDVGGNIIGTFFAI
QENLTI
Download sequence
Identical sequences A0A2G5E2H5
Aquca_013_00464.1|PACid:22060231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]