SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00480.1|PACid:22058629 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_013_00480.1|PACid:22058629
Domain Number - Region: 11-57
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 0.0523
Family Substrate-binding domain of HMG-CoA reductase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00480.1|PACid:22058629
Sequence length 308
Sequence
MGSSLPFFLWINVVVYLFIATKTMVAQQIEGAHVFDHVLGRYACESYNAHNKTGFLYEVQ
FPGNLSDIRADTVRFRCGSLKRYGAQVKEFNLAMGVTVQPCVERVLLVRQNLGEHWSPIY
FDTINVSANYQLVSHVLGLVAYDATNLNSANLSEVELHAGKNPIKIDFTNVAKINSTSGI
TLLCASFDSDGKTSVSPQVSPNICAATGHGHFALVIESFLSQTQNTKVSRWKIIVGSTLG
GALGVFLLGLLFHAMLVKVKKKSERVQMERRAYEEEALQISMVGHVRAPMASGTRTQPSL
EHEYIPPI
Download sequence
Identical sequences A0A2G5E1Y1
Aquca_013_00480.1|PACid:22058629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]