SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00637.1|PACid:22059844 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00637.1|PACid:22059844
Domain Number 1 Region: 104-181
Classification Level Classification E-value
Superfamily PH domain-like 0.0000168
Family VPS36 N-terminal domain-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00637.1|PACid:22059844
Sequence length 312
Sequence
MGFIKAPIQLSEKAGRKFAAHHRTEPNLHSAVGHSANTTFYNSPKTLFFAQILTPFRALG
KPDYQSEKKKKKSNCLRRMVLGLRNFSERTGDGSGSGEPVLDTMNGEDMMRVQTGVTIVL
GNGTPQSPGTLYITTKRVIWLNDVDKEIGYVVDFLSISLHAISRDPDSYPSPCIYAQIEA
EAGEDDDSEGSGSEANDTIDVSKITEMRLIPSDPSQLDALFDVFCECAELNPEPNEDHEE
EHNWIFSADQLDESMMPEVRDFEWQLSEDPGNPIGYSNGNHDVADSILELQIDDQRFDDA
EEMEREAQSGHQ
Download sequence
Identical sequences A0A2G5E3C6
Aquca_013_00637.1|PACid:22059844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]