SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00711.1|PACid:22060112 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00711.1|PACid:22060112
Domain Number 1 Region: 374-747
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.44e-112
Family Oxysterol-binding protein 0.0011
Further Details:      
 
Domain Number 2 Region: 54-86,115-170
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-16
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00711.1|PACid:22060112
Sequence length 757
Sequence
MRVKEMHPLCCISLENTVIGDQSPVISRNNGCFLPEVSGFGSENNVGKETVSEVNVAGVL
YKWTNYGKGWRSRWFLLRNGVVSYSKIRRSENFDDVKVIGDVSSGRLSRLDSRGRRKHQK
SVGFVHLKVSSFRESRADDRRFYIFTATKTLHLRTDSKKDRVAWIQALVSTRGLFSLRPL
NDDKLSLIPNNISISTEKLRKHLLEEGIDEVLVKDCEQIVLSEFSELQGQLKVLCEERSN
LLDTLRQLEAANTEVEASGINDGQFRLTTHEYTSSGRGKFSEWSTTESSDDIGRQELEEI
SDEDKASFFDTQEYFSESTENCESIIGDSHHVYTCTKAEDHVDTVERMHIESDLSNSRYP
HVERRIKLPDPMEKEKGVSLWSMIKDNVGKDLTQVCLPVYFNEPISSLQKCAEDLEYSYL
LDHAYEYGKKGNSLLRALYVAAFAVSGYASSEGRHCKPFNPLLGETYEADYPEKGIRFFS
EKVSHHPTLIACHCEGRGWKFWADSNLRTKFWGRSIQLDPVGVLTLQFDDGEIFQWNKVT
TAIYNLILGKVYCDHHGIMHIKGNRQHSCKLKFKEQSFLDRNPHQVQGSVEDAMGNKVAT
LFGKWDDSMYYIIGDVGTRQRNSDSLSNAALLWKRNKPPPNLTRYNLTSFAITLNELTSG
LQEKLPPTDSRLRPDQRHLENGEYERANAEKLRLEMRQRMSRKMQENGWKPRWFQKNVET
GSFCYAGGYWEAREQRKWDGCPQIFGELTVGNSCEAL
Download sequence
Identical sequences A0A2G5E331
Aquca_013_00711.1|PACid:22060112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]