SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_013_00793.1|PACid:22059685 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_013_00793.1|PACid:22059685
Domain Number 1 Region: 169-497
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.89e-47
Family DNA repair protein MutS, domain III 0.00087
Further Details:      
 
Domain Number 2 Region: 508-736
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.61e-46
Family ABC transporter ATPase domain-like 0.00000528
Further Details:      
 
Weak hits

Sequence:  Aquca_013_00793.1|PACid:22059685
Domain Number - Region: 9-69,99-181
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.0173
Family DNA repair protein MutS, domain II 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_013_00793.1|PACid:22059685
Sequence length 794
Sequence
MEEEGGGERSSFVIGLIENRAKEVGVAAFDMRSASLHLSQYIETSSSYQNTKTLLHFYDP
MVIIVPPNKLAADGMVGVSELVDRSYAASKKVVMTRGCFDDTKGSILVKTLAAKEPSALG
LDTYYKQYYLCLAAVSATIKWIEAEKGVIVTNHSLLVTFNGSFDHMNIDATSVQNLEIVE
PLHSNLWGSSNKKRSLFQMLKTTRTIGGTRLLRANLLQPLKDIETLNARLDCLDELMSNE
ELFFGLTQVLRKFPKETDRVLCHFCFKPKRVTNEVLRGDDAKRSQVLISSIILLKTALEA
LPLLSKVLKDAKSFLLQNIYKSICENGKYESIRKRIAEVIDDDVLHARVPFVARTQQCFA
VKAGIDGLLDVARRSFCDSSEAIHNLANKYRQDFQLPNLKIPFNSRQGFYLSIPHKDING
RLPSKFIQVVKHGNNVHCSTLELASLNVRNKSAAAECYTRTEICLEALVDGIRKDVFVLT
LLAEVLCLLDMIVNSFAHTISTKPVDRYTRPEFTDNGPLAIDAGRHPILESLHADFVAND
IFLSEALNMMIVMGPNMSGKSTYLQQVCLIVILAQIGCYVPARFSSLRMVDRIFTRMGTG
DNLESNSSTFMTEMKETAFIMQNVSSRSLIVMDELGRATSSSDGFAIAWSCCEHLLSLNA
YTIFATHMENLSELATVYPNVKIHHFHVDVKNNRLNFKFNLEDGPRYVPHYGFLLAEMAG
LPSQVIESAKSITSRITDKEVSRMEVNYMQYQSIQMAYRVAQRLICLKYSNHDEASIREA
LQNLKESYIDGRLE
Download sequence
Identical sequences A0A2G5E3L0
Aquca_013_00793.1|PACid:22059685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]