SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00060.1|PACid:22027782 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00060.1|PACid:22027782
Domain Number 1 Region: 36-314
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.55e-31
Family G proteins 0.0015
Further Details:      
 
Domain Number 2 Region: 578-700
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-20
Family Pleckstrin-homology domain (PH domain) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00060.1|PACid:22027782
Sequence length 919
Sequence
MDAIDELIQLSDSMVQAAALLADEDADEPSSKRNSTFLNVIALGNVGAGKSAVLNSLIGH
PVLPTGENGATRAPISIDLQRDGSLSNKSIVLQIDSKSQQVSASALRHSLQDRLSKSVAG
KGRTDEIYLKLRTSTAPPLKLIDLPGLDQRIMDDSLISEYVEHNDAILLIIVPAAQAPEI
STLRALKLAKEYDSDGTRTIGVISKIDQAASDQKTLAAVQALLLNQGPRNTSDIPWVALI
GQSVSIASAQSGSVGSENSLETAWRAESESLKSILTGAPQSKLGRLALVETLARQIRKRM
KVRLPNLLSGLQGKSQVVEDELVRLGEQMVTSAEGTRAIALELCREFEDRFLAHIATGEG
SGWKVVASFEGNFPNRIKQLPLDRHFDINNVKRIVLEADGYQPYLISPEKGLRSLIKGVL
ELAKEPSRLCVDEVHRVLVDIVSASANATPGLGRYPPFKREVVTIASAALDVFKNEAKKM
VVALVDMERAFVPPQHFIRLVQRRMDRQRREEEQKTRASKKGQDAEQSLLNRATSPQTGS
TSSGLPLKSMKDKSNQPDKPDKDAQEGSLKVAGTAGEITAGFLLKKSAKTNGWSRRWFVL
NEKSGKLGYTKKQEERNFRGVITLEECIVDEVVDEEEPPTKSSKDKKANGPDGKGPSLVF
KITSKVPYKTVLKAHSAVVLKAESMADKVEWMNKIRKVISGKGGSSTEAGLPIRQSLSDG
SLDTMSRRPADPEEELRWMSQEVRGYVEAVLNSLAANVPKAVVLCQVEKAKEDMLNQLYS
SISAQSTARIEELLQEDQNVKRRRERFQKQSSLLSKLTRQLSVHDNRAAAASSMSDGAAS
AESSPRTNVPDDWRSAFDAAANGKVDYNSVGRSSSNGHSRRYSDPANGDENSGSNSGSRR
TPNRLPPPPPQSGSSFYKY
Download sequence
Identical sequences A0A2G5DUI0
Aquca_014_00060.1|PACid:22027782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]