SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00068.1|PACid:22028355 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00068.1|PACid:22028355
Domain Number 1 Region: 49-144
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.44e-31
Family 2Fe-2S ferredoxin-related 0.0000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00068.1|PACid:22028355
Sequence length 146
Sequence
MATLLSGTMVSTSFMRKQVPVTTSLRSFSNVGQAPFGIKAGRGGRIIAMATYKVKLITPD
GEQEFDCPDDVYILDQAEEVGIDIPYSCRAGSCSSCCGKVVAGKVDQSDQSYLDDDQIGE
GFVLTCVAYPSSDVTLETHKEEELMG
Download sequence
Identical sequences A0A2G5DUD0
Aquca_014_00068.1|PACid:22028355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]