SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00136.2|PACid:22028144 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00136.2|PACid:22028144
Domain Number 1 Region: 92-167
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 8.28e-25
Family NifU C-terminal domain-like 0.00025
Further Details:      
 
Domain Number 2 Region: 170-238
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 0.00000000000000567
Family NifU C-terminal domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00136.2|PACid:22028144
Sequence length 240
Sequence
MQSVVLNPPCSCSAAQRTLEASCSGALLSLHPSFKNLGFKRTRISLIGTNFQLQKSSSIC
SFRLGRRDIKGSKLVVKAVATPDSALELPLTAENVESVLDEVRPYLMSDGGNVALHEIDG
NIVRLKLQGACGSCPSSVTTMKLGIERRLMEKIPEIVAVEPVTDEETGLELNEENIEQVL
AEIRPYLVGTGGGGLELVAIDEPIVKVRITGPAAAVMTVRVAVTQKLREKIPAIAAVQLL
Download sequence
Identical sequences A0A2G5DUQ3
Aquca_014_00136.2|PACid:22028144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]