SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00137.1|PACid:22027691 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00137.1|PACid:22027691
Domain Number 1 Region: 250-467
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.22e-63
Family CAT-like 0.00018
Further Details:      
 
Domain Number 2 Region: 39-130
Classification Level Classification E-value
Superfamily Single hybrid motif 2.62e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.00047
Further Details:      
 
Domain Number 3 Region: 176-222
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000222
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00137.1|PACid:22027691
Sequence length 469
Sequence
MANLLHIGSSFTSSTKLLIKNPKFSSNPTPIRRMRVQAKIREIFMPALSSTMTEGKIVSW
IKSEGDKLSKGESVVVVESDKADMDVETFYDGYLAAIMVDEGGVAAVGSAIALLAETEDE
IEEARLKASSSSSSPVTSEKPIETSVDSVTSPPPQPPSPKPSVSAVVTAASSIHPASEGG
KRVVASPYAKKLAKELKVDLTTVVGTGPLGRIVAKDVEALAASASSTPAIGSSKPATASA
PSVNIELGSVVPFTTMQGAVSRNMVESLTVPTFRVGYTITTDALDSLYKKIKTKGVTMSA
LLAKATALALVKHPVVNSSCRDGNSFTYNSSINIAVAVAIDGGLITPVLQDADKVDIYTL
SRKWKELVEKARAKQLQPHEYTTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPSL
VGTKDGRIGLKSQMQVNVTADHRVIYGADLAAFLQTLAKIIEDPKDLTL
Download sequence
Identical sequences A0A2G5DUQ9
Aquca_014_00137.1|PACid:22027691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]