SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00139.3|PACid:22027609 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00139.3|PACid:22027609
Domain Number 1 Region: 1445-1679
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.51e-19
Family WD40-repeat 0.0076
Further Details:      
 
Domain Number 2 Region: 107-146,471-626,839-858,966-985
Classification Level Classification E-value
Superfamily ARM repeat 0.0000472
Family HspBP1 domain 0.078
Further Details:      
 
Weak hits

Sequence:  Aquca_014_00139.3|PACid:22027609
Domain Number - Region: 792-860,960-1035
Classification Level Classification E-value
Superfamily ARM repeat 0.0345
Family Armadillo repeat 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00139.3|PACid:22027609
Sequence length 1874
Sequence
MEESGHSSSNNGRASHNIGRLGNLVRDNDDFFELLSSKFLSEARYSTSVRSAAARLVLSG
STTWMHPHVFEDEVLENIKNWVMDDNATLSVDECNGKSEFNRSDPTDSEMLKTYATGLLA
VSLAGGGQLVEDVLTSGLSSKLMRYLRTRVLGETSTNQKDVNYPAEGKSAAGSTCIRGRE
DSRGRFRQALDATHLDHPRIGDEVLVDDHSSERDHDKRIGSRQLHGEEQSDDDLSEGGGM
CELDEDGVELFGEEIRHNWESRDGKSDENVRDDSSRRKVNRVWARVRGKGRSIEGALENE
RSLTSPVSGIRLGQGRTIRDRNVSRNAELKGAPDTRKQSIRNDADAIPIGREDNDELFLE
CKVGARDISDLVKKATRAAEAEAMAANAPAEAIKAAGDAAAELVSTAALEAFKSTNDEEA
AVLAASEAASTVVDAANATEVSRSSVDANVGTKVVETEVDEELEGNFLLDKDTLAQLREK
YCIQCLETLGEYFEVLGPVLHEKGVDVCLALLQQNSQSTEIPKVMLLLPDVLKLICALAA
HRKFAAVFVDRGGIQKLLAVPRVSETFFGLSSCLFTIGSLQGIMERVCALPSDVVHQVVE
LALQLLQCSQDQARKNAAIFFAAAFVFKAVVDAFDTQEGLEKVLNLLLGAACVRSGGNSG
TLGLSNPGLLRNDRSPSEVLTASEKQVAYHTCVALRQYFRAHLLLLVDSIRPNKSHRSMA
RNISSARAAYKPLDISNEAMDAVFVQIQRDRKLGPAFVRTSWPAVNKFLNCNGHIIMLEL
CQAPPVERYLHDLAQYALGVLHIVTLVPYSRKSIVNATLSNDRVGMAVILDATNNSSYVD
PEVIQPALSVLVNLVCPPPSISNKSSVLAQGQLSGAVQTSNGPVIETRDRNYDRSLSMQN
ESRERNGEPSGVDRGNTTAHGTPSLNNSSQTVVPTTSGVVGDRRISLGPGSGCAGLAAQL
EQGYHQAREAVRANNGIKVLLHLLQSRILTPPATLDCLRALACRVLLGLARDDTIAHILT
KLQVGKKLSELIRDSGSQTPGSEQARWQAELAQVAIELIAIVTNSGRASTLAATDAAAPT
LRRIERAAIAAATPITYHSSELLLLIHEHLQASGLASTASSLLKEAQLSPLPTLAAPASA
LLHQTTVQENQTMQIHWPSGRAPRGFLSDTPHVKDDSSNFKRDSTMSSSKKKPLIFSTNL
SFQLKNQASCSPSSAMISCAFQTPSTATGAPETPTVSSSLKPTSDPEAQFKSPILLPLKR
KLTETKDIGFSPPVKRMATSEHGFRSPAFQTPIVRKSNLQVDVGVSAIPSSGQRDQFCRS
NATGVAFDNLDDNQHNHNVTPMCQMTPSTSQFGLLADPQPGNAERLTLDSIVVQYLKHQH
RQCPAPITTLPPLSLLHPHTCPESRHSFDAPSNVTARLSTREFRNWYGGIHGNRRDRQFV
YSRFRPWRTCRDDAALLTCLTFLGDSSQIATGGHSGELKIFDSNSGNMLESTAGHQSPVT
LVQSALSGDTRLVLSSASYDVRLWDASTISSGSTHSFEGCKSARFSNSGTAFAALSTESS
RREVLLYDIQTCNLDLKLTDTSSGPSGPGRGHGQSLIHFSPSDSMLLWNGVLWDRRGSGP
VQRFDQFTDYGGGGFHPSGNEVIINSEVWDLRKFKLLRSVPSLDQTVITFNTHGDVIYAI
LRRNLEDITSAVHSRRVRHPLFSAFRTVDAINYSDIATVPVDRCVLDFAAEPTDSFVGLV
TMDDHDEMFASARLYEIGRRRPTDDDSDPDDAESEEDEDDDDSDADGDSLLGHDLDGDLD
SDPDDLSNDEDDDSIDDLDEDEDDGEFNLEDVDFNGGGGVLEIVTEDEDDDDSEVIESFS
SGDEENFMGNGFGF
Download sequence
Identical sequences A0A2G5DUX6
Aquca_014_00139.3|PACid:22027609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]