SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00139.4|PACid:22027610 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00139.4|PACid:22027610
Domain Number 1 Region: 1518-1704
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.44e-16
Family WD40-repeat 0.01
Further Details:      
 
Domain Number 2 Region: 180-220,545-700,913-932,1040-1059
Classification Level Classification E-value
Superfamily ARM repeat 0.0000242
Family HspBP1 domain 0.078
Further Details:      
 
Weak hits

Sequence:  Aquca_014_00139.4|PACid:22027610
Domain Number - Region: 843-934,1034-1109
Classification Level Classification E-value
Superfamily ARM repeat 0.0288
Family Armadillo repeat 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00139.4|PACid:22027610
Sequence length 1719
Sequence
MEANSEAAADAVAMDENHDEEPEELEEPKNESEADSLLTKAQDLMARVTSSQLNPNPKVL
HALASMLENEESRYMEESGHSSSNNGRASHNIGRLGNLVRDNDDFFELLSSKFLSEARYS
TSVRSAAARLVLSGSTTWMHPHVFEDEVLENIKNWVMDDNATLSVDECNGKSEFNRSDPT
DSEMLKTYATGLLAVSLAGGGQLVEDVLTSGLSSKLMRYLRTRVLGETSTNQKDVNYPAE
GKSAAGSTCIRGREDSRGRFRQALDATHLDHPRIGDEVLVDDHSSERDHDKRIGSRQLHG
EEQSDDDLSEGGGMCELDEDGVELFGEEIRHNWESRDGKSDENVRDDSSRRKVNRVWARV
RGKGRSIEGALENERSLTSPVSGIRLGQGRTIRDRNVSRNAELKGAPDTRKQSIRNDADA
IPIGREDNDELFLECKVGARDISDLVKKATRAAEAEAMAANAPAEAIKAAGDAAAELVST
AALEAFKSTNDEEAAVLAASEAASTVVDAANATEVSRSSVDANVGTKVVETEVDEELEGN
FLLDKDTLAQLREKYCIQCLETLGEYFEVLGPVLHEKGVDVCLALLQQNSQSTEIPKVML
LLPDVLKLICALAAHRKFAAVFVDRGGIQKLLAVPRVSETFFGLSSCLFTIGSLQGIMER
VCALPSDVVHQVVELALQLLQCSQDQARKNAAIFFAAAFVFKAVVDAFDTQEGLEKVLNL
LLGAACVRSGGNSGTLGLSNPGLLRNDRSPSEVLTASEKQVAYHTCVALRQYFRAHLLLL
VDSIRPNKSHRSMARNISSARAAYKPLDISNEAMDAVFVQIQRDRKLGPAFVRTSWPAVN
KFLNCNGHIIMLELCQAPPVERYLHDLAQYALGVLHIVTLVPYSRKSIVNATLSNDRVGM
AVILDATNNSSYVDPEVIQPALSVLVNLVCPPPSISNKSSVLAQGQLSGAVQTSNGPVIE
TRDRNYDRSLSMQNESRERNGEPSGVDRGNTTAHGTPSLNNSSQTVVPTTSGVVGDRRIS
LGPGSGCAGLAAQLEQGYHQAREAVRANNGIKVLLHLLQSRILTPPATLDCLRALACRVL
LGLARDDTIAHILTKLQVGKKLSELIRDSGSQTPGSEQARWQAELAQVAIELIAIVTNSG
RASTLAATDAAAPTLRRIERAAIAAATPITYHSSELLLLIHEHLQASGLASTASSLLKEA
QLSPLPTLAAPASALLHQTTVQENQTMQIHWPSGRAPRGFLSDTPHVKDDSSNFKRDSTM
SSSKKKPLIFSTNLSFQLKNQASCSPSSAMISCAFQTPSTATGAPETPTVSSSLKPTSDP
EAQFKSPILLPLKRKLTETKDIGFSPPVKRMATSEHGFRSPAFQTPIVRKSNLQVDVGVS
AIPSSGQRDQFCRSNATGVAFDNLDDNQHNHNVTPMCQMTPSTSQFGLLADPQPGNAERL
TLDSIVVQYLKHQHRQCPAPITTLPPLSLLHPHTCPESRHSFDAPSNVTARLSTREFRNW
YGGIHGNRRDRQFVYSRFRPWRTCRDDAALLTCLTFLGDSSQIATGGHSGELKIFDSNSG
NMLESTAGHQSPVTLVQSALSGDTRLVLSSASYDVRLWDASTISSGSTHSFEGCKSARFS
NSGTAFAALSTESSRREVLLYDIQTCNLDLKLTDTSSGPSGPGRGHGQSLIHFSPSDSML
LWNGVLWDRRGSGPVQRFDQFTDYGGGGFHPSGNEVCFT
Download sequence
Identical sequences A0A2G5DUP2
Aquca_014_00139.4|PACid:22027610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]