SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00159.1|PACid:22028351 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00159.1|PACid:22028351
Domain Number 1 Region: 393-770
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.45e-120
Family Oxysterol-binding protein 0.00061
Further Details:      
 
Domain Number 2 Region: 70-107,141-198
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-19
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00159.1|PACid:22028351
Sequence length 775
Sequence
MSTQMPTTIRSNSMNRSRQLTPTTTTIITTTKGVGFGGNDHSRLIQTFSRLPSLQEPRDV
KINDIVGNGISGILDKWVNYGKGWRPRWFVLQDGVLSYYKIHGPDKIQIDQDSDKRSKII
GEESFRFISRHKNPSIPRKNPVGEVHLKVSSIRESRSDDKRFSIFTGTKRLHLRADARED
RVAWMEALQAMKDMFPRMSNSELMAPVDNAVVCTDKLRQRLLDEGVDEAAIQESEQIIRT
EFSGLQNQLVLLKQKQSLLIDTLRYLETEKVDLENTLVDESQRQSNGHEASFRSSQERNS
DVTVSGSEDDNERNDAAEEETDDDENTFFDTRDFLSSSSFRSSGSEFRISSFDSDEELYT
FDSENSTEASIKDVGSDYPRVRRRKKLPEPVEKEKGVSLWSMIKDNIGKDLTKVCLPVYF
NEPLSSLQKCYEDLEYSFLLDRAHEWGKRGNSLMRMLNVAAFAVSGYASTDGRNCKPFNP
LLGETYEADYPDKGLRFFSEKVSHHPMIVACHCEGKGWKFWGDSNLKSKFWGRSIQLDPV
GLLTLEFDDGEIFQWSKVTTSIYNLILGKLYMDHYGTMRIQGNREYSCKLKFKEQSIIDR
NPHQVQGVVQDRNGKTAATLIGKWDESMHYVLGDCSGKGRGSESLSNAHILWKRSNPPKF
PTRYNFTRFATTLNELTPGLKEKLPPTDSRLRPDQRCLENGEYEMANSEKLRLEQRQRQA
RKMQERGWKPQWFVKDKETETYRYTGGYWEARNKGNWESCLDIFGQVPTDQITDE
Download sequence
Identical sequences A0A2G5DUV9
Aquca_014_00159.1|PACid:22028351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]