SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00277.1|PACid:22029059 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00277.1|PACid:22029059
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-21
Family B3 DNA binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00277.1|PACid:22029059
Sequence length 149
Sequence
MAKITIRASNPHFVVPIMPREPQENIAIPKSFLRNYLIGEKCARKATLRTRKSRKSWKVN
LKGLCFEDGWDDFSTAHDLQDGDFLVFKHEGDLTFYVTVFDPSECEKEYPSVNVTNDDQK
MEKGATTKKKMKKVSKKSSSNFSFYIFSF
Download sequence
Identical sequences A0A2G5DVH1
Aquca_014_00277.1|PACid:22029059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]