SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00282.1|PACid:22028670 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00282.1|PACid:22028670
Domain Number 1 Region: 271-365
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-18
Family B3 DNA binding domain 0.0064
Further Details:      
 
Weak hits

Sequence:  Aquca_014_00282.1|PACid:22028670
Domain Number - Region: 39-80
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0353
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00282.1|PACid:22028670
Sequence length 396
Sequence
MARDCECCKQWRKQLFWIDNEPPTVHFFFKVLMDGFHEKLFASNNSLEKHDLMVFRFNES
LERDCCFKVMFFDKTACEKEGVACVRESDKPGLDTNGIQSVQINKDCTNNVLSSERSPCS
SESSGKHSSERSWDSIDSCYYVTSGEESSEDSSDSSSVNRQTRENTFRVRHGYPSTLRVK
KNPRQNLPVKKNRKSANNDNLQKSNKVHVSRNKDRVPRADTKSKGKSRLNPTLSGTSKKL
SYYRYFQSQRRPVTFEEEYLTLKKAQALERNSTKPHFIKVMKRTHVYMRFFMTIPPKFIR
KNFSEVPEMALLRVTGKAKAWKVTIITKGLDNLQPGISGGWADFVMENNLEKGDACLFEL
DNINPNYESVVTVDVTIFRVVDKIVPLNRMLVKPPL
Download sequence
Identical sequences A0A2G5DVK9
Aquca_014_00282.1|PACid:22028670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]