SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00299.1|PACid:22028863 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00299.1|PACid:22028863
Domain Number 1 Region: 3-37
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000392
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00299.1|PACid:22028863
Sequence length 67
Sequence
MQGSGCQVGIGGGWRDFVMDNNLEAGDACLFELDNIKPSYNMAALDVSIFRVVDKIVPLK
IIVADSP
Download sequence
Identical sequences A0A2G5DVU7
Aquca_014_00299.1|PACid:22028863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]