SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00329.1|PACid:22028150 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00329.1|PACid:22028150
Domain Number 1 Region: 573-861
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.9e-38
Family WD40-repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 213-334,389-491
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000103
Family Protein kinases, catalytic subunit 0.016
Further Details:      
 
Domain Number 3 Region: 7-67
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000252
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00329.1|PACid:22028150
Sequence length 864
Sequence
MEEEEEEEEEMQYPECPVCLQVYNNETTIPRVLSCGHSACQTCLPQLPQRFPNIIRCPSC
NQLVHYPNNHGGSSSLPKNIDLLSFISQQQQHQQNPQNPNPQYPNSSEKSVKQLSQGHEF
LPKFWSEEFYTIWKDWVLEIDSIEIEMIGVGDGDDHDPHISLLRGRKDGEIVSLLYVGSA
VLNDSVFDFSYVVRIMQFLYQLNGSLRDELCLILRSLKLRFRVCKVYGLWMNSENGSVFL
VCEMLNSDLKEKLSEWRNRIVCENGNEVIRDGKQRKELNWGMPGFAVVGMELCEALASLH
ADGLVSGCLALSCFHFDGFGRVFVNSNEVLVLGRRIRKWVREFAASGCQRSEETERIMDD
IIKIQPTVNLELLFSLLHKEGVALDFGSSECSVGYFSDVWSLGCILVSFLDGGGLNHEYF
YQLIPQIGEKTCDEFLGLYTDWVERVNLLLENLLGPDYVALHQILCRCLEYDPGNRPLVT
DVWKCIRDLLVRPQDDILGSLDTGGSLKNMIHCISLGHMCDMPTENDREFQNQNDHNLEG
SGVAIGFQQDGDGKNEKNLVEGLRIGKFECVDLMGHADCISGLAVGGGFLFSSSFDKTVN
VWSLQDCSHVQSFKGHEHRVMGVVFVDAAEPLCVSGDSGGGIFVWGVGASLQQDPLKSWY
EQKDWRYSGIHALAVSGTEHIYTGSGDKSVKAWSLQDYTLVCTMNGHKSVVSSLVVCDGV
LYSGSWDGTIRLWSINDHSPLTVLGDDTPGNLTSVLSLSVYHHTLAAAYENGCVKLWRND
MLSRSIETQSGAIFALDIKEEWLFMGGWNKTVDVKELSGNELHVDSRSVGSVACNSVVTA
VLYWEGKLFIGLADTSVKVYSYRS
Download sequence
Identical sequences A0A2G5DWI4
Aquca_014_00329.1|PACid:22028150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]