SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00329.2|PACid:22028151 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00329.2|PACid:22028151
Domain Number 1 Region: 573-813
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-38
Family WD40-repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 213-334,389-492
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000857
Family Protein kinases, catalytic subunit 0.016
Further Details:      
 
Domain Number 3 Region: 7-67
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000024
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00329.2|PACid:22028151
Sequence length 823
Sequence
MEEEEEEEEEMQYPECPVCLQVYNNETTIPRVLSCGHSACQTCLPQLPQRFPNIIRCPSC
NQLVHYPNNHGGSSSLPKNIDLLSFISQQQQHQQNPQNPNPQYPNSSEKSVKQLSQGHEF
LPKFWSEEFYTIWKDWVLEIDSIEIEMIGVGDGDDHDPHISLLRGRKDGEIVSLLYVGSA
VLNDSVFDFSYVVRIMQFLYQLNGSLRDELCLILRSLKLRFRVCKVYGLWMNSENGSVFL
VCEMLNSDLKEKLSEWRNRIVCENGNEVIRDGKQRKELNWGMPGFAVVGMELCEALASLH
ADGLVSGCLALSCFHFDGFGRVFVNSNEVLVLGRRIRKWVREFAASGCQRSEETERIMDD
IIKIQPTVNLELLFSLLHKEGVALDFGSSECSVGYFSDVWSLGCILVSFLDGGGLNHEYF
YQLIPQIGEKTCDEFLGLYTDWVERVNLLLENLLGPDYVALHQILCRCLEYDPGNRPLVT
DVWKCIRDLLVRPQDDILGSLDTGGSLKNMIHCISLGHMCDMPTENDREFQNQNDHNLEG
SGVAIGFQQDGDGKNEKNLVEGLRIGKFECVDLMGHADCISGLAVGGGFLFSSSFDKTVN
VWSLQDCSHVQSFKGHEHRVMGVVFVDAAEPLCVSGDSGGGIFVWGVGASLQQDPLKSWY
EQKDWRYSGIHALAVSGTEHIYTGSGDKSVKAWSLQDYTLVCTMNGHKSVVSSLVVCDGV
LYSGSWDGTIRLWSINDHSPLTVLGDDTPGNLTSVLSLSVYHHTLAAAYENGCVKLWRND
MLSRSIETQSGAIFALDIKEEWLFMGGWNKTVDVKVCIIIMLA
Download sequence
Identical sequences A0A2G5DVT1
Aquca_014_00329.2|PACid:22028151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]