SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00438.1|PACid:22028997 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_014_00438.1|PACid:22028997
Domain Number - Region: 248-325
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0497
Family Myosin rod fragments 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00438.1|PACid:22028997
Sequence length 336
Sequence
MSDFMSSPKPFVSFVELEHEAASEELPVLKECTQPTFTAEECQPLSPCSEKSNSLALNEN
GGVLPDNQRIQNDAMNQIDVSMESLVLPHSSNVTESSSLLHTTFEDKSHYDNVSGDERDL
ILGDITANTCSFPKQQDEGLFSLPDESLPFVKHPDLWESVESLEVFQRMPQKPHFRPLKQ
YEEETREGYAIANMLNFANLVQKTLKAKLDEPRSVYESRLKILADLEEHGFTVQPIRAVL
EGILNMKASYTELDDKTKKAEKEFVEEKGKLVEVEESIVEVEDYITQLNIKLQTLVKDKE
MRSSTIAERQRKVAEFQEHIQGVKLDFEKMVASMFS
Download sequence
Identical sequences A0A2G5DWJ7
Aquca_014_00438.1|PACid:22028997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]