SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Aquca_014_00460.2|PACid:22028395 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_014_00460.2|PACid:22028395
Domain Number 1 Region: 3-134
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.57e-33
Family G proteins 0.00000928
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_014_00460.2|PACid:22028395
Sequence length 155
Sequence
MEDRLVTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVLKSFDTLDNWHDEFLKQAN
PVDPSSFPFILLGNKVDIDGGNSRVVSEKKAKEWCLSRGNIPYFETSAKEAYNVDAAFLC
VAKTALANEHDQDIYFQNIPEAVSETEQRGGGCAC
Download sequence
Identical sequences A0A2G5DXA1
Aquca_014_00460.2|PACid:22028395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]